PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_003914-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 259aa    MW: 30252.9 Da    PI: 8.7215
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_003914-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.4e-182168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll+++vk +G g+W+++ar  g++R +k+c++rw +yl
  AHYPO_003914-RA 21 KGPWTAEEDRLLIEYVKFHGEGRWNSVARLTGLRRNGKSCRLRWVNYL 68
                     79********************************************97 PP

2Myb_DNA-binding53.36.2e-1774118147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ +++d+++++G++ W+tIar ++ gRt++++k++w+++
  AHYPO_003914-RA  74 RGQITPHEESIILDLHAKWGNR-WSTIARSLP-GRTDNEIKNYWRTH 118
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4221668IPR017930Myb domain
SuperFamilySSF466891.32E-3019115IPR009057Homeodomain-like
SMARTSM007172.7E-162070IPR001005SANT/Myb domain
PfamPF002499.7E-172168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-232275IPR009057Homeodomain-like
CDDcd001671.96E-112368No hitNo description
PROSITE profilePS5129424.30869123IPR017930Myb domain
SMARTSM007176.8E-1573121IPR001005SANT/Myb domain
PfamPF002499.2E-1474118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2476122IPR009057Homeodomain-like
CDDcd001675.06E-1078119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MMGTYNMGMS WGMIEDGGWR KGPWTAEEDR LLIEYVKFHG EGRWNSVARL TGLRRNGKSC  60
RLRWVNYLRP DLKRGQITPH EESIILDLHA KWGNRWSTIA RSLPGRTDNE IKNYWRTHFK  120
KKEKTSPNKT PEKSKTHLLR KQQFQQEQQQ RQQQRFTSLD MRKMMSLLLD DNENKLTAVN  180
SVPQVLETCN DWINNPSTTN IVSDQEQRIL ISSSSEEGSN NENDVLGCWD NNGANFWNFD  240
DLQWSIFCAR SADYPFCS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-262112227127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010693964.12e-92PREDICTED: transcription factor MYB48-like
TrEMBLA0A0J8BBF82e-90A0A0J8BBF8_BETVU; Uncharacterized protein
STRINGBra015029.1-P2e-82(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.11e-74myb domain protein 305